SKU: 36553995108

Biotinylated CD155/PVR His&Avi Tag Protein, Human

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD155/PVR His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5 Accession P15151 Amino Acid Sequence Trp21 Asn343, with C terminal 8*His&Avi tag

Product Specification


Species Human
Synonyms PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5
Accession P15151
Amino Acid Sequence

Trp21-Asn343, with C-terminal 8*His&Avi tag WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNIEGRMDHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

65-75kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Kučan Brlić P. et al. (2019) Targeting PVR (CD155) and its receptors in anti-tumor therapy. Cell Mol Immunol. 16(1): 40-52.

Background

CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic virotherapy. More intriguingly, PVR participates in a considerable number of immunoregulatory functions through its interactions with activating and inhibitory immune cell receptors. These functions are often modified in the tumor microenvironment, contributing to tumor immunosuppression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36553995108

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Pablo
Natrona Heights, US
★★★★★ 5
A good one, albeit not a perfect one
It is a comprehensive look into the series with lots of wonderful art. I felt that it was thinner than the previous book from the Avatar series but I'm not talking about the length of the book (I know this one has less pages an only covers one season) but rather about the "insights" into the creative process. While the previous book felt full to the seams and you could feel that there was a lot of important material that didn't fit, you also felt that all the material that did was included was the best. In this one for Korra, you feel that there were many important things left out that should have been included and there are some things that were included that doesn't feel as important...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2013
D
Verified Purchase
Diwen
Alexandria, US
★★★★★ 5
Everything you wanted put into a art book
I loved this art book. It showed me basically everything I wanted to see from back drops used and unused, old character designs and how some things came to be or what they were inspired by. The commentary is great though rarely confusing (Ex: at one point they commentary refers to a picture in the top right but says "As you can see by the design in the middle" the middle being something completely different) I feel like this book is a must for fans and people interested in the art of the series alike.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2015
B
Verified Purchase
Bunny Wolf
Fort Morgan, US
★★★★★ 5
This is how you make an artbook!!
It's so awesome to open an artbook and see every stage of the character and how it all came together. It's always fun and interesting to know how Korra was made, and why whe looks the way it looks. It's really cool to read the different ideas that came up for a certain character and why they decided that a certain design worked better than the previous ones! It's also really interesting and delicious to read about how they inspired themselves in known architecture to create the environment in this tv series. I simply loved it and I'm excited to know that I'll be buying the other Korra artbooks!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 23, 2014
N
Verified Purchase
Nicolas Calderon Eader
Alexandria, US
★★★★★ 4
Great artwork for a great series!! Recommended to artists, animators and fans of the series
It's been a while since the Avatar: The Last Airbender series ran on TV. I really loved that series because it dealt with a lot of eastern cultures themes and it was not the average children TV show. Despite its children characters the show runners manged to find a balance between drama and comedy. Now about the art book: that series (Avatar) had its own book (all seasons in one single book) but this time we are getting one book entirely dedicated to the first season, which makes it great. Why? Because we are getting more artwork per episode, most of it in full-color. I would have liked to see more of the character design, I mean how they got to the final version. Most of the characters are shown in their final version with some costume variants but that's it, no development. One thing missing this time (both from the series and this book) is the animal designs. They had a lot 2-animal-fusion designs on the previous show but this time we get to see almost nothing. I know it is because the series is takes place mainly in Republic City. And wow! what a nice city it is. All the artwork dedicated to set Republic City's mood, the 1920s, the steam-punk influence, the fashion, everything just fits perfectly! There is a couple of aerial views (day & night) which are my favorite from the book. This new guy they hired to do the background paintings has done a great job! Every background and every building design have so much detail that they will make your jaw just drop. I like the fact they are paintings with no pencil lines, just paint brushed over the design, which makes it look richer! Now, I am giving this book a 4-star rating because of the reasons I have already explained and the fact that we are not getting that much in-depth information like we got from the Avatar art book . I must say this is not an animation book, this is an art book that depicts backgrounds, characters and vehicles. You will get to see a few storyboarded sequences but this book is not intended to teach you about animation. I seriously recommend this book to any person interested in art and animation. The artwork is so well achieved that you will be left wanting to see more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2014
F
Verified Purchase
Fred C
Lexington, US
★★★★★ 5
Inspirational for Concepts and Illustration
I am learning to be a Concept Designer and Illustrator and this art book is inspirational. This art book has well presented examples for most every part of the conception and finishing process for characters, environments, costumes, props, and story. It has a good amount of design concepts from everything about the series first season: character designs, character sheets, building and city designs, costumes, vehicles, etc. I only wish is was longer/bigger. They could put all 4 seasons into one large encompassing volume.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2016

recommand products