Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated Nectin-2/CD112 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD112, Nectin 2, PVRL2 Accession Q92692 2 Amino Acid Sequence Gln32 Leu360, with C terminal 8*His&Avi tag
Product Specification
| Species | Human |
| Synonyms | CD112, Nectin-2, PVRL2 |
| Accession | Q92692-2 |
| Amino Acid Sequence | Gln32-Leu360, with C-terminal 8*His&Avi tag QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 45-54kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Minai-Fleminger Y. et al. (2009) Mast cells and eosinophils: the two key effector cells in allergic inflammation. Inflammation Research. 58(10): 631-638. |
Background
Nectin-2, also known as CD112, is a cell adhesion molecule that belongs to the Nectin family. Nectin is highly homologous to human poliovirus receptors and also known as a poliovirus receptor-associated protein. The Nectin family consists of four members: Nectin-1, Nectin-2, Nectin-3, and Nectin-4. Nectin protein had three consecutive immunoglobulin-like domains outside the cell, namely, the Ig-V domain at the N terminal and two Ig-C2 domains at the C terminal. Nectin-2 is found in neurons, endothelial cells, epithelial cells, and fibroblasts. Nectin-2 can bind pseudorabies virus and herpes simplex virus-2 (HSV-2) and participate in the intercellular transmission of these viruses, but cannot bind HSV-1 and has a low binding affinity with TIGIT. Nectin-2 was identified as a ligand for DNAM-1 (CD226), whose CD226/CD112 interaction mediates cytotoxicity and cytokine secretion in T and NK cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy