SKU: 43390607490

PCSK9 His Tag Protein, Rat

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

PCSK9 His Tag Protein, RatProduct Specification Species Rat Synonyms PCSK9, FH3, PC9, FHCL3 Accession P59996 Amino Acid Sequence Gln31 Gln691, with C terminal 10*His

Product Specification


Species Rat
Synonyms PCSK9, FH3, PC9, FHCL3
Accession P59996
Amino Acid Sequence Gln31-Gln691, with C-terminal 10*His QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 60-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Jaén R I. et al. (2022) Functional Crosstalk between PCSK9 Internalization and Pro-Inflammatory Activation in Human Macrophages: Role of Reactive Oxygen Species Release. Int J Mol Sci. 23(16): 9114.

Background

PCSK9 (proprotein convertase subtilisin-kexin type 9) is a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. PCSK9 undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Atherosclerosis is a cardiovascular disease caused mainly by dyslipidemia and is characterized by the formation of an atheroma plaque and chronic inflammation. Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a protease that induces the degradation of the LDL receptor (LDLR), which contributes to increased levels of LDL cholesterol and the progress of atherosclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43390607490

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 5
Son loves them!
Size: Large, Color: Black (6-pairs), Number of Items: 6
My son loves these socks! Comfy, good quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
T
Verified Purchase
Tori M
Draper, US
★★★★★ 5
Good fabric
Size: Medium, Color: White, Number of Items: 6
Nice socks. Would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
S
Verified Purchase
Sarge Howell
Battle Creek, US
★★★★★ 4
Quality and durable socks
Size: Large, Color: White (6-pairs), Number of Items: 6
Great quality socks. This pack was a lot taller on the cuff and bigger than previous batches I have had. Not sure what the change was, but giving it 4 instead of 5 because I preferred the smaller shorter ones they previously made. But these are great quality socks, and last a long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
R
Verified Purchase
Rafael Mota
Phoenix, US
★★★★★ 5
A Game-Changer for Comfort
Size: Medium, Color: Black, Number of Items: 6
I recently upgraded my workout gear with the Under Armour Training Cotton Quarter Socks, and I must say, these socks have revolutionized my exercise experience. Comfortable, durable, and stylish, they truly stand out in the crowded world of athletic socks. First and foremost, the comfort level of these socks is unparalleled. The blend of cotton and synthetic materials provides a soft and plush feel against my feet, making every step a pleasure. The quarter length strikes the perfect balance, offering ample coverage without being too restrictive or too short. It's like walking on clouds, even during the most intense workouts. One of the standout features is the moisture-wicking technology. I've worn these socks during high-intensity cardio sessions, and they have consistently kept my feet dry and comfortable. The breathability is remarkable, preventing that uncomfortable feeling of sweaty feet that often accompanies strenuous workouts. No more distractions – just focus on pushing through your fitness routine. Durability is another strong suit of these socks. After numerous washes, they maintain their shape and elasticity, showing no signs of wear and tear. The reinforced heel and toe areas provide extra support, ensuring longevity and preventing the dreaded sock holes that often plague other brands. The sleek design of the Under Armour Training Cotton Quarter Socks adds a touch of style to my workout attire. The subtle logo and choice of colors make them versatile enough to pair with any athletic shoes. Whether you're hitting the gym, going for a run, or simply running errands, these socks seamlessly blend fashion with function. In terms of sizing, I found that they fit true to size. The elastic band around the arch provides a snug yet comfortable fit, ensuring that the socks stay in place throughout any activity. While the price point may be slightly higher than some other options on the market, the quality and performance of the Under Armour Training Cotton Quarter Socks more than justify the investment. When it comes to comfort, durability, and style, these socks have become an indispensable part of my workout wardrobe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2024
C
Verified Purchase
Carol Foshag
Birmingham, US
★★★★★ 5
Well made
Size: Large, Color: Black (6-pairs), Number of Items: 6
These are the only socks that my 12 year old Grandson will wear. He's very picky. LOL
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026

recommand products