Pay in installments of $90.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
COL6A3 His Tag Protein, HumanProduct Specification Species Human Synonyms COL6A3, collagen, type VI, alpha 3 Accession P12111 Amino Acid Sequence Thr3101 Thr3177, with N terminal 8*His HHHHHHHHTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT Expression System HEK293 Molecular Weight 11 13kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution
Product Specification
| Species | Human |
| Synonyms | COL6A3, collagen, type VI, alpha 3 |
| Accession | P12111 |
| Amino Acid Sequence | Thr3101-Thr3177, with N-terminal 8*His HHHHHHHHTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT |
| Expression System | HEK293 |
| Molecular Weight | 11-13kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Kim, Gloria B et al. (2022) Quantitative immunopeptidomics reveals a tumor stroma-specific target for T cell therapy. Science translational medicine. 14: 660. |
Background
Mutations in the genes COL6A1, COL6A2, and COL6A3, coding for three α chains of collagen type VI, underlie a spectrum of myopathies. The COL6A3 gene provides instructions for making one component of type VI collagen, which is a flexible protein found in the space that surrounds cells. The COL6A3 protein is a component of type VI collagen and is present in connective tissues throughout the body, but exon 6 is only expressed in stromal cells in the tumor microenvironment. Collagen is found in the extracellular matrix, which is necessary for cell stability and growth. Research suggests that type VI collagen links basement membranes, which are thin, sheet-like structures that are part of the extracellular matrix, to nearby cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.7 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 5
Lasted 7 MONTHS - perfect pack of bones!
Size: Medium, Style: 4 Pack
Lasted us 7 months! Our Belgian mal chews on these non-stop and treats them like her high value treats. We just re-ordered the 7 pack!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
★★★★★ 5
Recommended by my breeder
Size: Small, Style: Wishbone/Dental
Purchased these two small sized Benebones for my puppy Springer Spaniel. It’s one of her favorite toys and it is well used and well worn. Replaced these with the medium size recently as she’s almost full grown now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
★★★★★ 5
Dogs love them and long lasting
Size: Large, Style: Wishbone/Dental
My dogs love these chew toys and they have lasted nearly 2 months and they still have plenty of chew left to them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
★★★★★ 5
The only chew toy that has actualy held up...for well over 2 years!
Size: Medium, Style: 4 Pack, Size: Medium, Style: 4 Pack
These things are amazing! They last forever even with dogs that can destroy nearly everything else in mins! I ordered these as a doggie Xmas gift over TWO YEARS AGO, and they are still pretty much fully intact! They chew on them all the time, too!(see pics; that's over two years of steady use!) I only got the one 4 pack, and have 4 dogs, too!
Since making them so well does kind of reduce my ability to buy many more from them, I feel I should at least let people know they really are crazy durable and dogs love them! I will prob buy another 4 pack soon, just so they are easier to find(end up under couches,etc). Def a good buy!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
★★★★★ 5
Built for heavy chewers and actually holds up
Size: Medium, Style: Fishbone/Wishbone
This chew toy is a total win for heavy chewers and has held up really well compared to so many others we’ve tried. It keeps dogs busy for long stretches and they stay genuinely interested in it instead of destroying it in minutes. The shape makes it easy for them to grip and chew comfortably, which adds to how much they use it. The durability is the real standout here, making it one of those rare toys that actually earns a repurchase. The material feels sturdy, it’s easy to clean, and there’s no noticeable odor, which is always a plus.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026