SKU: 23175722919

BMPRIA/ALK-3 Fc Chimera Protein, Mouse

Sale price$212.40 Regular price$236.00
Save 10%

Pay in installments of $59.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 25 - Jul 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BMPRIA/ALK-3 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen ALK 3 BMPRIA Synonyms 10q23del; ACVRLK3; ALK3 Accession P36895 Amino Acid Sequence Gln24 Arg152, with C terminal Mouse IgG Fc

Product Specification


Species Mouse
Antigen ALK-3/BMPRIA
Synonyms 10q23del; ACVRLK3; ALK3
Accession P36895
Amino Acid Sequence

Gln24-Arg152, with C-terminal Mouse IgG Fc QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-53kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):2878-83. Epub 2002 Feb 19.

Background

Activin receptor-Like Kinase 3 (ALK-3), also known as Bone Morphogenetic Protein Receptor, type IA (BMPR1A), is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the transforming growth factor beta (TGF-β) superfamily. The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A (this protein) and BMPR1B and the type II receptor BMPR2. ALK-3 plays an essential role in the formation of embryonic ventral abdominal wall, and abrogation of BMP signaling activity due to gene mutations in its signaling components could be one of the underlying causes of omphalocele at birth.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23175722919

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bekah Jenkins
Alexandria, US
★★★★★ 5
Fun set
Color: All-Around Dog Puzzle Toys
Super cute and dog feeding kit with lots of options at a great price. The balls are a little on the flimsy side, but for the price the set is hard to beat. I have a 12 pound dachshund who is a fast eater, but also loves a good challenge. While the toy is not difficult for her to figure out (she is a little to smart for her own good) it does at least slow her down enough that she chews her food some. The sliders on the feeder move around easily which make it easy to clean and refill, but also make it a lot easier for her to get to the food. It is probably comparable to a level one difficulty for anyone who has tried the Outward Hound food toy games.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
J
Verified Purchase
Jen L
Boise, US
★★★★★ 5
Very sturdy products esp for my big chewers
Color: All-Around Dog Puzzle Toys, Color: All-Around Dog Puzzle Toys
My dogs loved these, loved the lick pads as they have suctions, we personally use it for when we are bathing since my dogs hate baths, we just stick it onto the wall. The puzzles were fun which kept them entertained, the balls that had we were able to put treats in them, my dog loved it more as a ball as they are very ball driven. I bought this weeks ago and it’s extremely sturdy. Also easy to clean.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
K
Verified Purchase
Kim Wood
Boise, US
★★★★★ 5
Doggie approved!
Color: All-Around Dog Puzzle Toys, Color: All-Around Dog Puzzle Toys
⭐️⭐️⭐️⭐️⭐️ **Perfect Mental Workout for My German Shepherd!** This 9 Pack All-Around Dog Puzzle Toy Set has been an absolute game-changer for my German Shepherd. As a highly intelligent and energetic breed, he needs more than just physical exercise, and these puzzles provide the mental stimulation he craves. Each toy offers a different challenge level, keeping him engaged and focused instead of bored or restless. I love the variety in the set—it makes it easy to rotate the puzzles so he doesn’t lose interest. The toys are sturdy and well-designed, holding up well to my German Shepherd’s strength while still being easy to clean. They also help slow down treat time and encourage problem-solving, which is great for his overall behavior and enrichment. If you have a smart, high-energy dog like a German Shepherd, this puzzle set is a must-have. It keeps him mentally sharp, entertained, and happily challenged every day! 🐕🧠⭐
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 24, 2025
S
Verified Purchase
Sun Chi
Alexandria, US
★★★★★ 5
Great long lasting chew
Flavor Name: Peanut Butter, Size: Large, Flavor Name: Peanut Butter, Size: Large
We really like having these bones on hand to keep our power chewing pitties busy. The large sizes are super convenient and long lasting, and our dogs really seem to enjoy them. We have gone through several orders over the last few years, and I anticipate to keep buying this brand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
D
Verified Purchase
Darla Tuttle
Dallas, US
★★★★★ 5
Durable and loved dog chew toy bone
Flavor Name: Bacon, Size: Medium
The dogs seem to love chewing on it. It has held up pretty well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products